PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g55446.1.p
Common NameBRADI_1g55446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 311aa    MW: 34338.3 Da    PI: 7.1288
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g55446.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1346.5e-11110162456
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                        k+ +r+++NR++Ar sR +K  ++++L+     LeaeNk L k+   l +++
  Bradi1g55446.1.p 110 EKVKMRRESNRISARLSRYKKATQMQNLQHQLSLLEAENKYLVKRQADLIQKY 162
                       5899************************************9997766555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.4E-8107171IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-8109159No hitNo description
PROSITE profilePS502179.105109161IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.44E-8111162No hitNo description
PfamPF001702.8E-7111160IPR004827Basic-leucine zipper domain
CDDcd146868.02E-10113161No hitNo description
PfamPF124988.5E-28178285IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MNCAKLLHDA TIKQPSCFDL NFWHVRPQAS RSSQSNTTSN QGSQNYIGDN EILVQQMSGG  60
GQYGGTSPNL AQNPDVSVRQ VSSPLREQSP STNNIEGEAE TMGNMNFSAE KVKMRRESNR  120
ISARLSRYKK ATQMQNLQHQ LSLLEAENKY LVKRQADLIQ KYSSAVIDNR VLKANVETLE  180
TKVKLVEEII KRFTSTHDVP QVVSSLTSLG FPLSASPSNG AHETFVPTQN TPFNYFTSVT  240
TNGGVNNIYT PEATSTFQIQ DPVALLQMQS ESSLEHLQRR VCDSAPSSSV LAPQEVTSFN  300
PNEFINMGMQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230029.10.0PREDICTED: regulatory protein opaque-2-like
TrEMBLA0A0Q3K7X80.0A0A0Q3K7X8_BRADI; Uncharacterized protein
STRINGBRADI1G55450.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2520255
Representative plantOGRP18391639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-16bZIP family protein